PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco000069.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 622aa    MW: 66405.6 Da    PI: 6.473
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco000069.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.3e-32263320260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK+vkgse+prsYY+Ct+++C+v+k++ers+ d++++ei+Y+g+H+h+k
  Aco000069.1 263 EDGYNWRKYGQKHVKGSENPRSYYKCTHPNCNVRKQLERSH-DGQITEIIYKGKHDHPK 320
                  8****************************************.***************85 PP

2WRKY105.92.2e-33435493159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Aco000069.1 435 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNIGCPVRKHVERASHDPKAVITTYEGKHNHD 493
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28260321IPR003657WRKY domain
SuperFamilySSF1182907.32E-25261321IPR003657WRKY domain
SMARTSM007741.7E-35262320IPR003657WRKY domain
PROSITE profilePS5081124.501263321IPR003657WRKY domain
PfamPF031062.0E-24263319IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-37420495IPR003657WRKY domain
SuperFamilySSF1182901.14E-29427495IPR003657WRKY domain
PROSITE profilePS5081138.733430495IPR003657WRKY domain
SMARTSM007741.5E-39435494IPR003657WRKY domain
PfamPF031063.9E-26436493IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MEESPANAGD LACGGREGAT PAPELGSEGL AAGGGGSGSV GEGAAVHPRV SSLAAASAAR  60
YKAMSPGRLP IATRAPCLTI PQGFSPSALL ESPVLLTNIK ARDLTPFSLP SKAEPSPTTG  120
TLNISYMMNR SVHSSKLSSP RETSNSVYSD KSSGDFEFKL HAGSSLHSAV PSLLPQDSAD  180
GKLEECEASV QIQSQVQNHK SAPVIPQTAL TQPIENITLK AGVHSEIACD ELQQIDSSDK  240
TMQELQSNLS GSAPLPVLEK SAEDGYNWRK YGQKHVKGSE NPRSYYKCTH PNCNVRKQLE  300
RSHDGQITEI IYKGKHDHPK PQPNRRSAVG VLSSQGEEKA DSLVNAEDKS SNALDHLCNH  360
VNPIVTPELS PASASEDEVD VGCGQSNTID EVADDDDPES KRRKMDITTI DAATIGKPNR  420
EPRVVVQTVS EVDILDDGYR WRKYGQKVVK GNPNPRSYYK CTNIGCPVRK HVERASHDPK  480
AVITTYEGKH NHDVPAARNA SHEISAPIPM VTNSSNLISN RMPAALSSIL SIGNPRVTSH  540
QYTQLAGSDT VSLDLGVGIN PNHGNAGNEI QSLGSNQIQH HQSTLYGSRE DDGEGFTFKA  600
TPMNHSANMY YTSAGNLVLG P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-38263496878Probable WRKY transcription factor 4
2lex_A7e-38263496878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396393.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ6VWJ60.0WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLA0A0B5GUL90.0A0A0B5GUL9_9POAL; WRKY17 transcription factor (Fragment)
STRINGLOC_Os07g39480.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-127WRKY family protein